PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G222400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 304aa    MW: 32514.6 Da    PI: 4.4067
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G222400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-12143194455
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +k+ rr ++NR +A +sR+RKk +++ Le k+k Leae ++L   l+ +  e
  Sevir.4G222400.1.p 143 SKKKRRQMRNRDSAMKSRERKKTYVKDLEAKSKYLEAECRRLSYALQCYAAE 194
                         79*************************************9999877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-6139204IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-12139203No hitNo description
PROSITE profilePS502179.829142205IPR004827Basic-leucine zipper domain
PfamPF001706.0E-10144200IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.69E-11144202No hitNo description
CDDcd147042.53E-15145196No hitNo description
PROSITE patternPS000360147162IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDIDLFADID LDALLASFSG EPAGVSGLID PSPPPPAPTA AHDAEAGSPE SVTSRASPPG  60
EEALTEIERL LMQEGEAELG GEAEGISVEE FFDALYDGGE GEREGKESEA GGSTDGDSGR  120
DEVVEVVTPE AETVEVDGDD PVSKKKRRQM RNRDSAMKSR ERKKTYVKDL EAKSKYLEAE  180
CRRLSYALQC YAAENMVLRQ SLLKDRPVGA PTAMQESAVL TETLPLVSLL WLVSIVCLFL  240
MPGLPNRSPA APSSAGRDLG MVTGKTSSEN PDILELILHG RRCKGTRAKI KLDKLPFHAV  300
AAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143147KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0864640.0BT086464.1 Zea mays full-length cDNA clone ZM_BFc0169L15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965858.10.0PREDICTED: bZIP transcription factor 60-like
TrEMBLK3XYH00.0K3XYH0_SETIT; Uncharacterized protein
STRINGSi006978m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-15basic region/leucine zipper motif 60